PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02498.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 396aa    MW: 42694.9 Da    PI: 6.4119
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02498.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.85.8e-1645831856
                                  HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  lF++ ++p++++r+eL+k+lgL+ rq+k+WFqNrR+++k
  Zpz_sc02498.1.g00040.1.sm.mk 45 LFKQYPHPDEKQRAELSKRLGLEPRQIKFWFQNRRTQMK 83
                                  7***********************************999 PP

2START76.37.7e-25152218140206
                                   TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 140 ssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                    s+v +++ pSg+++++++ng +kvtwveh+++++++ h+l+r+l++sgla+ga +w+atlqrqce+
  Zpz_sc02498.1.g00040.1.sm.mk 152 DSSVNCRRQPSGCVMQDTPNGLCKVTWVEHTEYDEASMHQLYRPLLQSGLAFGAGRWLATLQRQCEC 218
                                   58899************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-83889IPR001356Homeobox domain
SuperFamilySSF466892.59E-134589IPR009057Homeodomain-like
PfamPF000462.8E-134583IPR001356Homeobox domain
CDDcd000868.85E-144685No hitNo description
Gene3DG3DSA:1.10.10.601.9E-144692IPR009057Homeodomain-like
PROSITE profilePS5007114.3664685IPR001356Homeobox domain
PRINTSPR000313.1E-55665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000313.1E-56581IPR000047Helix-turn-helix motif
PfamPF018523.9E-20152218IPR002913START domain
SuperFamilySSF559615.22E-9152218No hitNo description
PROSITE profilePS5084817.105155221IPR002913START domain
SuperFamilySSF559612.93E-7282389No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MSFGGLFDCC EGPGAMAGVQ YPAVSGVVAS SPALSLALVR VATVLFKQYP HPDEKQRAEL  60
SKRLGLEPRQ IKFWFQNRRT QMKTQLERHE NALLKQENDK LRAENQSVRE ALTNLVCGNC  120
GGPAMLGEVS LEEHHLRLEN ARLRDELTHS LDSSVNCRRQ PSGCVMQDTP NGLCKVTWVE  180
HTEYDEASMH QLYRPLLQSG LAFGAGRWLA TLQRQCECLA ILMSSIAMPE HDSAGVSASS  240
AREWSKLDCL TGSIGADVRV MVRKSVDEPG VPPGVVLSAA TSPTSTNQNS MLILQETCTD  300
ESGAMVVYAP VDIPAMQLVM GGGDSTYVAL LPSGFAILPG GPCISAKTNG SLLTVAFQIL  360
VNSQPTAKLT AESVDTVNNL IACTIKKIKA ALHCDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652658.11e-119PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ6EPF01e-117ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0D3FZ331e-120A0A0D3FZ33_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H4K31e-120A0A0E0H4K3_ORYNI; Uncharacterized protein
STRINGOB04G29090.11e-119(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2104245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.18e-93homeodomain GLABROUS 1